A practical reference on angiotensin IV: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-07-09 and is reviewed periodically as new material appears.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
Regulatory status differs by country, but dihexa is generally not approved as a therapeutic product. It is often sold as a research chemical, which means purity, labeling, and handling fall outside pharmaceutical drug standards. Some jurisdictions restrict the sale of peptides intended for human consumption. Researchers and suppliers may therefore face different legal requirements depending on location. Import rules and customs enforcement can also affect how such compounds move across borders.
Human safety data are sparse. No widely accepted dosing regimen, long-term safety profile, or clinical efficacy endpoint has been established. Published animal results can suggest directions for further study, but species differences and study design limit direct translation. Open questions include bioavailability, blood-brain barrier penetration, metabolism, and whether observed effects arise from a single target or multiple pathways. Replication across independent laboratories remains an important benchmark for evaluating the strength of preclinical claims.
| Property | Value | Notes |
|---|---|---|
| Chemical name | N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Common full name in research literature. |
| Class | Synthetic peptide | Modified angiotensin IV analog. |
| Related compound | Angiotensin IV | Parent peptide fragment. |
| Proposed target | HGF/c-Met pathway | Described as an HGF mimetic; not fully confirmed. |
| Development status | Preclinical research | No widely approved clinical use. |
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
Human data for dihexa remain absent from peer-reviewed clinical literature. As a result, questions about absorption, distribution, metabolism, excretion, and long-term safety are unresolved. Discussions often appear in nootropic forums, where anecdotal reports cannot substitute for controlled trials. Researchers have called for more rigorous pharmacokinetic and toxicological studies before any clinical evaluation. Until such data exist, dihexa is best described as an investigational research compound rather than a proven intervention.
Photograph 1. – Open rhinoplasty: The incisions are endonasal (in the nose), and thus are hidden. The skin-incision to the columella aids the plastic surgeon in precisely suturing to hide the scar—except for the columellar incision (red-dot guideline) across the nasal base. The columellar incision allows the surgeon to view the size, shape, and condition of the nasal cartilages and bones to be corrected. Photograph 2. – Open rhinoplasty: The nasal interior. The scissors indicate the lower lateral cartilage (blue), which is one of the wing-shaped cartilages that conform the tip of the nose. The jagged red delineation indicates the locale of the columellar incision. Once the skin has been lifted from the bone-and-cartilage framework, the surgeon performs the nasal correction tasks. Photograph 3. – Open rhinoplasty: To narrow the tip of a too-wide nose, the surgeon first determines the cause of the excess nasal width. The suture being emplaced will narrow the tip of the nose. The red delineation indicates the edge of the nose-tip cartilage, which is narrowed when the surgeon tightens the folded cartilage apex. The suture (light blue) ends in the needle (white); tweezers (green) hold the nasal cartilage in place for the suturing. Photograph 4. – Nasal hump excision: The black delineation indicates the desired nose-reduction outcome: a straight nose. The nasal hump is bone (red) above the scalloped grey line, and cartilage (blue) below the scalloped grey line.
Willard Marriott gained franchise rights for Washington, D.C., Baltimore and Richmond. Subsequently, he moved to Washington to open a root beer stand with Hugh Colton. These stands subsequently became Hot Shoppes, paving the way for the later creation of one of the largest hospitality corporations in the world. As of 1933, A&W had a total of 171 stands, increasing to 260 by 1941. A&W survived the Great Depression and labor shortages during World War II but benefitted from the post-war recovery of the American economy, with fast food and drive-in restaurants beginning to take shape. The first franchise convention was held in La Crosse, Wisconsin in 1949, but was limited to Wisconsin franchisees.
Ammonium bicarbonate is an inorganic compound with formula (NH4)HCO3. It is the bicarbonate salt of the ammonium ion. It is a colourless solid that degrades readily to carbon dioxide, water and ammonia.
== List == In the table below, glycemic and insulin scores show the increase in the blood concentration of each. The Insulin Index is not the same as a glycemic index (GI), which is based exclusively on the digestible carbohydrate content of food, and represents a comparison of foods in amounts with equal digestible carbohydrate content (typically 50 g). The insulin index compares foods in amounts with equal overall caloric content (240 kcal or 1000 kJ). Insulin indexes are scaled relative to white bread, while glycemic index scores nowadays are usually scaled with respect to pure glucose, although in the past white bread has been a reference point for GI measurements as well. A higher satiety value indicates increase of satiety after eating a serving of equal overall caloric content, scaled relative to white bread.
Sources: en.wikipedia.org
When a bioactive ligand with a known structure is to be screened against a protein with limited structural information, modeling is done with regard to ligand structure. Pharmacophore modeling identifies key electronic and structural features that are associated with therapeutic activity across similarly bioactive structural analogs, and accordingly requires large libraries with corresponding experimental data to enhance predictive power. Compound structures are superimposed virtually and common elements are scored on the basis of their tendency toward bioactivity. The move away from lock-and-key based modeling toward induced-fit based modeling has improved binding predictions but has also given rise to the challenge of modeling ligand flexibility, which requires building a database of conformational models and uses large amounts of data storage space. Another approach is the so-called on-the-fly method, in which conformational models are tested during the process of pharmacophore modeling, without a database; this method requires significantly less storage space at the cost of high computing time. A second challenge arises from the decision of how to superimpose analog structures. A common approach is to use a least-squares regression for superimposition, but this requires user-selected anchor points and therefore introduces human bias into the process. Pharmacophore models require training data sets, giving rise to another challenge—selection of the appropriate library of compounds to adequately train models.
As he was not an expert in either chemistry or computer programming, he collaborated with Stanford chemist Carl Djerassi to help him with chemistry, and Edward Feigenbaum with programming, to automate the process of determining chemical structures from raw mass spectrometry data. Feigenbaum was an expert in programming languages and heuristics, and helped Lederberg design a system that replicated the way Djerassi solved structure elucidation problems. They devised a system called Dendritic Algorithm (Dendral) that was able to generate possible chemical structures corresponding to the mass spectrometry data as an output. Dendral then was still very inaccurate in assessing spectra of ketones, alcohols, and isomers of chemical compounds. Thus, Djerassi "taught" general rules to Dendral that could help eliminate most of the "chemically implausible" structures, and produce a set of structures that could now be analyzed by a "non-expert" user to determine the right structure. The new rules include more knowledge of mass spectrometry and general chemistry. He also expanded the system so it can incorporate to NMR spectroscopy data in addition to mass spectrometry data. The Dendral team recruited Bruce Buchanan to extend the Lisp program initially written by Georgia Sutherland. Buchanan had similar ideas to Feigenbaum and Lederberg, but his special interests were scientific discovery and hypothesis formation.
== Awards and recognition == In 2022, MrMed was awarded the Health Care Start-up Of The Year by the Federation of Indian Chambers of Commerce and Industry (FICCI) in Chennai, presented by Ma. Subramanian, the Minister for Health and Family Welfare, Government of Tamil Nadu.
November 13, 2009: Germany, Eurozone Germany's growth of 0.7% in the third quarter helped lead the Eurozone out of the recession after providing overall growth of 0.4% in the same period, with the whole European Union growing 0.2%.
Moist desquamation is a description of the clinical pattern seen as a consequence of radiation exposure where the skin thins and then begins to weep because of loss of integrity of the epithelial barrier and decreased oncotic pressure. Moist desquamation is a rare complication for most forms of radiology; however, it is far more common in fluoroscopy where threshold doses lie between 10 and 15 Gy and increasingly common above 15 Gy. It has been noted that fractionation of fluoroscopic procedures significantly reduces the likelihood of moist desquamation occurring. In animal studies done on pig skin, moist desquamation was found to occur with a 50% of the time after a single dose of 28 Gy; however, a 2×18 Gy fractionation scheme (36 Gy total dose) was needed to produce the same 50% occurrence. Moist desquamation is a common side effect of radiotherapy treatment, where approximately 36% of radiotherapy patients will present with symptoms of moist desquamation. While modern megavoltage external beam radiotherapy have peak radiation doses below the skin, older orthvoltage systems have peak radiation doses at the skin of a patient. As such, moist desquamtation and other skin related radiotherapy complications were significantly more commonplace before the introduction of higher energy cobalt therapy and linear accelerator systems between the 1950s to 1970s. Historically, this was a common phenomenon in Hiroshima and Nagasaki during World War II with the atomic bomb attacks from the United States.
Sources: en.wikipedia.org
The Spartanburg Pellagra Hospital in Spartanburg, South Carolina, was the first facility in the United States dedicated to discovering the cause of pellagra. It was established in 1914 with a special Congressional appropriation to the U.S. Public Health Service and set up primarily for research. In 1915, Dr. Joseph Goldberger, assigned to study pellagra by the surgeon general of the United States, showed it was linked to diet by observing the outbreaks of pellagra in orphanages and mental hospitals. Goldberger noted that children between the ages of 6 and 12 (but not older or younger children at the orphanages) and patients at the mental hospitals (but not doctors or nurses) were the ones who seemed most susceptible to pellagra. Goldberger theorized that a lack of meat, milk, eggs, and legumes made those particular populations susceptible to pellagra. By modifying the diet served in these institutions with "a marked increase in the fresh animal and the leguminous protein foods," Goldberger was able to show that pellagra could be prevented. By 1926, Goldberger established that a diet that included these foods, or a small amount of brewer's yeast, prevented pellagra. Goldberger experimented on 11 prisoners (one was dismissed because of prostatitis). Before the experiment, the prisoners were eating the prison fare fed to all inmates at Rankin Prison Farm in Mississippi. Goldberger started feeding them a restricted diet of grits, syrup, mush, biscuits, cabbage, sweet potatoes, rice, collards, and coffee with sugar (no milk).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
== Function == Angiogenin is a key protein implicated in angiogenesis in normal and tumor growth. Angiogenin interacts with endothelial and smooth muscle cells resulting in cell migration, invasion, proliferation and formation of tubular structures. Ang binds to actin of both smooth muscle and endothelial cells to form complexes that activate proteolytic cascades which upregulate the production of proteases and plasmin that degrade the laminin and fibronectin layers of the basement membrane. Degradation of the basement membrane and extracellular matrix allows the endothelial cells to penetrate and migrate into the perivascular tissue. Signal transduction pathways activated by Ang interactions at the cellular membrane of endothelial cells produce extracellular signal-related kinase1/2 (ERK1/2) and protein kinase B/Akt. Activation of these proteins leads to invasion of the basement membrane and cell proliferation associated with further angiogenesis. The most important step in the angiogenesis process is the translocation of Ang to the cell nucleus. Once Ang has been translocated to the nucleus, it enhances rRNA transcription by binding to the CT-rich (CTCTCTCTCTCTCTCTCCCTC) angiogenin binding element (ABE) within the upstream intergenic region of rDNA, which subsequently activates other angiogenic factors that induce angiogenesis. However, angiogenin is unique among the many proteins that are involved in angiogenesis in that it is also an enzyme with an amino acid sequence 33% identical to that of bovine pancreatic ribonuclease (RNase A).
== Description and history == The Chicken McNugget is a small piece of processed chicken meat that is fried in batter and flash-frozen at a central manufacturing facility, then shipped out and sold at McDonald's restaurants. It was conceived by Keystone Foods founder Herb Lotman in the late 1970s. McDonald's first executive chef, René Arend, a native of Luxembourg, created the Chicken McNuggets recipe in 1979. "The McNuggets were so well-received that every franchise wanted them", said Arend in a 2009 interview. "There wasn't a system to supply enough chicken". Supply problems were solved by 1983, and Chicken McNuggets became available nationwide in the United States. In Canada, the national release was in late January 1984. According to McDonald's, the nuggets come in four shapes: the bell, the bone (or the bow-tie), the ball and the boot. The reason for the four different shapes is to ensure consistent cooking times for food safety. Four shapes were chosen because McDonalds states "The 4 shapes we make Chicken McNuggets in was the perfect equilibrium of dipability and fun. 3 would’ve been too few. 5 would’ve been, like, wacky." In 2014, as part of McDonald's U.S. "Our Food. Your Questions." transparency campaign, the company released a behind-the-scenes video explaining how Chicken McNuggets are made.
Sources: en.wikipedia.org
Dihexa is a synthetic peptide analog of angiotensin IV, often described as an HGF mimetic in research literature. It is studied for effects on synaptic connectivity in laboratory models. It is not an approved medication.
No, dihexa is a synthetic compound derived from the structure of angiotensin IV. Angiotensin IV occurs naturally, but dihexa has modifications that change its properties. It is not a standard dietary component.
The main hypothesis is that dihexa interacts with the hepatocyte growth factor system, possibly through c-Met signaling. This interaction may influence synaptogenesis and neuronal plasticity. The exact molecular target remains an active area of study.
Published human clinical trial data are limited or absent. Most available evidence comes from laboratory and animal studies. Human safety and efficacy remain unresolved.