mass spectrometry is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-08-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Human data for dihexa remain absent from peer-reviewed clinical literature. As a result, questions about absorption, distribution, metabolism, excretion, and long-term safety are unresolved. Discussions often appear in nootropic forums, where anecdotal reports cannot substitute for controlled trials. Researchers have called for more rigorous pharmacokinetic and toxicological studies before any clinical evaluation. Until such data exist, dihexa is best described as an investigational research compound rather than a proven intervention.
The proposed mechanism for dihexa centers on hepatocyte growth factor, or HGF, and its receptor c-Met. HGF signaling is involved in cell growth, survival, and synapse formation. Dihexa has been described as an HGF mimetic or modulator in preclinical literature. Whether it binds c-Met directly, increases HGF availability, or acts through another route remains uncertain. This mechanistic uncertainty is a recurring theme in reviews of the compound, and no single molecular model has been confirmed across independent laboratories.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
| Property | Value | Notes |
|---|---|---|
| Chemical name | N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Common full name in research literature. |
| Class | Synthetic peptide | Modified angiotensin IV analog. |
| Related compound | Angiotensin IV | Parent peptide fragment. |
| Proposed target | HGF/c-Met pathway | Described as an HGF mimetic; not fully confirmed. |
| Development status | Preclinical research | No widely approved clinical use. |
Identity and purity are usually assessed with reverse-phase high-performance liquid chromatography and mass spectrometry. These methods can separate related impurities and confirm molecular mass, but they do not by themselves establish biological activity. Certificate of analysis documents may report purity as a percentage by area, yet the exact meaning can vary between laboratories. Independent testing can check for residual solvents, counterions, or microbial contamination when relevant. For research use, matching analytical records to a specific lot helps trace experimental variability.
Dihexa occupies an uncertain regulatory space in many countries. It is not generally listed as an approved therapeutic, and some jurisdictions may treat it as a research chemical, a compounded substance, or an unapproved new drug depending on claims and distribution. Importation can be restricted, and suppliers may require documentation that the material is for laboratory research only. Quality and labeling vary, so buyers should request analytical data, verify lot numbers, and understand local rules. These factors make sourcing and compliance part of the practical context around dihexa.
Regulatory status varies by country, and dihexa is not widely approved as a medicine. In many jurisdictions it is treated as a research chemical, which limits its legal sale, possession, and human use. Products marketed online may lack verified purity or identity, and labels can be inaccurate. Researchers typically source material from suppliers that provide analytical documentation and follow institutional safety rules. Open questions remain about long-term stability, metabolite formation, and human pharmacokinetics.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
Research interest in dihexa centers on its ability to promote synapse formation in cultured neurons and in some rodent experiments. These findings have been interpreted as a possible mechanism for learning and memory effects, but the evidence remains preliminary. Independent replication is limited, and study designs vary widely in species, duration, and outcome measures. Human data are scarce, so claims about cognitive enhancement in people are not supported by robust clinical evidence. The gap between laboratory signals and proven clinical benefit is substantial.
Dihexa appears in scientific literature, patent documents, and commercial catalogs under several names, which can complicate searching and verification. The compound is frequently grouped with nootropics or research chemicals, terms that describe context of use rather than regulatory approval. Such labeling may imply benefits that have not been confirmed in controlled human studies. Readers encountering promotional descriptions should distinguish between preclinical observations and established medical facts. The absence of regulatory approval is a central feature of its current status.
The clinical significance of bilirubin glucuronide is involved in many conditions. Drugs that inhibit the activities of the components involved in bilirubin metabolism can give rise to accumulation of bilirubin in the blood. In comparison, conjugation of some drugs is also usually impaired if the liver cannot normally metabolize indirect bilirubin. When excretion of bilirubin glucuronide by the kidney is detected in the urine through urine examination, meaning that a conspicuous amount of conjugated bilirubin is present and circulating in the blood. In Dubin–Johnson syndrome, impaired biliary excretion of bilirubin glucuronide is due to a mutation in the canalicular multiple drug-resistance protein 2 (MRP2). A darkly pigmented liver is due to polymerized epinephrine metabolites, not bilirubin.
Gastrointestinal side-effects (nausea, vomiting, diarrhoea) are common; the delayed-release formulation is meant to help overcome this problem. It is also a cause of drug-induced hepatitis. Patients with glucose-6-phosphate dehydrogenase deficiency should avoid taking aminosalicylic acid as it causes haemolysis. Thyroid goitre is also a side-effect because aminosalicylic acid inhibits the synthesis of thyroid hormones. Drug interactions include elevated phenytoin levels. When taken with rifampicin, the levels of rifampicin in the blood fall by about half. It is not known whether it will harm an unborn baby. With heat, 4-aminosalicylic acid is decarboxylated to produce CO2 and 3-aminophenol.
An article in the Hindustan Times stated: "A male star who started the trend of taking his shirt off in films and a younger star who flaunted his rippling muscles in a double role in a recent hit film also rely heavily on steroids. Model-actor and former Mr India Aryan Vaid says, "I know of 'trainers' of mega stars who don't know a thing about fitness. Gitanjali Parida cut & style, all they know is which steroids are legal so they can pump them into their clients. Most of the knowledge they have is off the Internet. But, they do good business because they have big names as their clients, some of whom pay these trainers as much as Rs 1 lakh a month for getting them perfect bodies. I've seen actors and models take injections to bulk up even before photo shoots... they don't realise what it's doing to their body.". In the same article, Satya Chaurasia, the fitness trainer whose clients include Aamir Khan and Hrithik Roshan, and he clarified that none of his clients have ever used steroids. "It's a common practice in Bollywood to take anabolic steroids to bulk up fast for photo sessions or shoots. I don't recommend them because I know the consequences."
7. Ir Med J. 2013 May;106(5):148-9. Atypical melanocytic naevi following melanotan injection. Reid C(1), Fitzgerald T, Fabre A, Kirby B. Author information: (1)Dermatology Department, St Vincent's University Hospital, Elm Park, Dublin 4. C.Reid@st-vincents.ie Melanotan is a synthetic analogue of alpha melanocyte stimulating hormone (a-MSH) that stimulates melanogenesis. It is sold on the internet and tanning salons as a quick 'tanning jab'. We report a patient who developed multiple new onset atypical naevi within one week of receiving two Melanotan injections. This case highlights the potential risk of Melanotan in stimulating dysplastic naevi or possibly malignant melanoma.
Different isoforms of actin are present in the cell nucleus. The level of actin isoforms may change in response to stimulation of cell growth or arrest of proliferation and transcriptional activity. Research on nuclear actin is focused on isoform beta. However the use of antibodies directed against different actin isoforms allows identifying not only the cytoplasmic beta in the cell nucleus, but also alpha- and gamma-actin in certain cell types. The presence of different isoforms of actin may have a significant effect on its function in nuclear processes, as the level of individual isoforms can be controlled independently. Functions of actin in the nucleus are associated with its ability to polymerize and interact with various ABPs and with structural elements of the nucleus. Nuclear actin is involved in:
Sources: en.wikipedia.org
ACTA2 (actin alpha 2) is an actin protein with several aliases including alpha-actin, alpha-actin-2, aortic smooth muscle or alpha smooth muscle actin (α-SMA, SMactin, alpha-SM-actin, ASMA). Actins are a family of globular multi-functional proteins that form microfilaments. ACTA2 is one of six different actin isoforms and is involved in the contractile apparatus of smooth muscle. ACTA2 (as with all the actins) is extremely highly conserved and found in nearly all mammals. In humans, ACTA2 is encoded by the ACTA2 gene located on 10q22-q24. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, Moyamoya disease, and multisystemic smooth muscle dysfunction syndrome. ACTA2 (commonly referred to as alpha-smooth muscle actin or α-SMA) is often used as a marker of myofibroblast formation. Studies have shown that ACTA2 is associated with TGF-β pathway that enhances contractile properties of hepatic stellate cells leading to liver fibrosis and cirrhosis.
Yonath was accepted to Tichon Hadash high school since her mother could not pay the tuition, she traded her time teaching math lessons to students, which helped pay for her schooling. At a young age, she said, she was inspired by the scientist Marie Curie. However, she stressed that Curie, whom she as a child was fascinated by after reading her biography, was not her "role model". She returned to Jerusalem for college, graduating from the Hebrew University of Jerusalem with a bachelor's degree in chemistry in 1962, and a master's degree in biochemistry in 1964. In 1968, she obtained her PhD from the Weizmann Institute of Science for X-ray crystallographic studies on the structure of collagen, with Wolfie Traub as her PhD advisor. Yonath accepted postdoctoral positions at Carnegie Mellon University (1969) and MIT (1970). While a postdoctoral researcher at MIT she spent some time in the laboratory of subsequent 1976 chemistry Nobel Prize winner William N. Lipscomb, Jr. of Harvard University where she was inspired to pursue very large structures.
June 13 – 23: 2019 Men's Softball World Championship in Prague-Havlíčkův Brod Argentina defeated Japan, 3–2, to win their first Men's Softball World Championship title. Canada took third place. July 23 – 27: Europe/Africa Softball 2020 Olympic Qualifier in Utrecht Italy defeated Great Britain, 5–0, to book their team and compete at the 2020 Summer Olympics. July 26 – 30: 2019 Women's U12 Softball World Cup in Tainan (debut event) Chinese Taipei defeated Peru, 3–2, to win the inaugural Women's U12 Softball World Cup title. The Czech Republic took third place. Indonesia took fourth place. August 10 – 17: 2019 Women's U19 Softball World Cup in Irvine The United States defeated Japan, 4–3, to win their third consecutive and seventh overall Women's U19 Softball World Cup title. Canada took third place. August 25 – September 1: Americas Softball 2020 Olympic Qualifier in Surrey Champions: Mexico; Second: Canada; Third: Puerto Rico Note: Both Mexico and Canada have qualified to compete at the 2020 Summer Olympics. September 24 –28: Asia/Oceania Softball 2020 Olympic Qualifier in Shanghai Champions: Australia; Second: Chinese Taipei; Third: China Note: Australia has qualified to compete at the 2020 Summer Olympics.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
CCL7 is a multipotent chemokine involved in anti-bacterial, anti-viral and anti-fungal immune responses. For example, CCL7-mediated stimulation of CCR2 chemokine receptors on monocytes is participating in the elimination of Listeria monocytogenes infections by the recruitment of monocytes and TNF/iNOS-producing dendritic cells (TipDCs). Next, the role of the CCL7 was also observed in the mouse infected by West Nile Virus. The genetically deficient mice in CCL7 have increased mortality because of decrease in monocytes and neutrophils. Early induction of CCL7 downstream of TLR9 signaling also promotes the development of robust immunity to cryptococcal infections. Diseases associated with CCL7 dysregulation are observed. For example, an abnormal increase of CCL7 worsens many disorders, like HIV or lesional psoriasis. Furthermore, CCL7 is implicated in various immunological diseases, as ulcerative colitis, multiple sclerosis or nonatopic and atopic asthma. It seems, that the expression of CCL7 can activate an antitumor immune response.
15. Biofizika. 2014 Sep-Oct;59(5):1023-6. [Main mechanisms of rhabdomyolysis-caused kidney injury and their correction by organospecific peptides]. [Article in Russian] Zamorskiĭ II, Shchudrova TS. The influence of the organospecific peptides--kidney tripeptides T-31 and T-35, pineal tetrapeptide epitalon on the main mechanisms of kidney injury caused by experimental rhabdomyolysis--toxic injury of tubular cells, development of oxidative stress and energetic misbalance, leading to significant disturbances of the functional state of kidneys and development of acute kidney failure was studied. The renoprotective effect of oligopeptides realized by impact on all of the indicated mechanisms of kidney injury and confirmed by correlation between them was estimated.
Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).
Alloxan is a toxic glucose analogue, which selectively destroys insulin-producing cells in the pancreas (that is, beta cells) when administered to rodents and many other animal species. This causes an insulin-dependent diabetes mellitus (called "alloxan diabetes") in these animals, with characteristics similar to type 1 diabetes in humans. Alloxan is selectively toxic to insulin-producing pancreatic beta cells because it preferentially accumulates in beta cells through uptake via the GLUT2 glucose transporter. Studies suggest alloxan does not cause diabetes in humans. Others found a significant difference in alloxan plasma levels in children with and without type 1 diabetes. Alloxan (C4H2N2O4) readily undergoes redox cycling with its one-electron (C4H3N2O4• semiquinone) and two-electron (dialuric acid, C4H4N2O4) reduction products. In the presence of intracellular reductants such as glutathione (or other thiols), this leads to the generation of toxic reactive oxygen species (ROS) via the interaction of alloxan reduction products with molecular oxygen and related species:
Pituitary prolactin is controlled by the Pit-1 transcription factor, which binds to the gene at several sites including a proximal promoter. This promoter is inhibited by dopamine and stimulated by estrogens, neuropeptides, and growth factors. Estrogens can also suppress dopamine. Interaction with neuropeptides is still a matter of active research: no specific prolactin-releasing hormone has been identified. It is known that mice react to both VIP and TRH, but humans seem to only react to TRH. There are prolactin-releasing peptides that work in vitro, but whether they deserve their name has been questioned. Oxytocin does not play a large role. Mice without a posterior pituitary do not raise their prolactin levels even with suckling and oxytocin injection, but scientists have yet to identify which specific hormone produced by this region is responsible. In birds (turkeys), VIP is a powerful prolactin-releasing factor, while peptide histidine isoleucine has almost no effect.
Sources: en.wikipedia.org
Dihexa is a synthetic peptide analog of angiotensin IV, often described as an HGF mimetic in research literature. It is studied for effects on synaptic connectivity in laboratory models. It is not an approved medication.
No, dihexa is a synthetic compound derived from the structure of angiotensin IV. Angiotensin IV occurs naturally, but dihexa has modifications that change its properties. It is not a standard dietary component.
The main hypothesis is that dihexa interacts with the hepatocyte growth factor system, possibly through c-Met signaling. This interaction may influence synaptogenesis and neuronal plasticity. The exact molecular target remains an active area of study.
Dihexa has been proposed to act through HGF and c-Met signaling. This pathway is linked to synapse formation and cellular growth. Direct binding and the precise molecular step remain uncertain.